PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA03g23210
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family MYB
Protein Properties Length: 227aa    MW: 27098.5 Da    PI: 9.9429
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA03g23210genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.38.5e-19449147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     rg W + Ede+l+++v+++G+++W++Ia+ ++ gR++k+c++rw++ 
       CA03g23210  4 RGHWRPHEDEKLKELVAKYGPHNWNAIAENLQ-GRSGKSCRLRWYNQ 49
                     899*****************************.************96 PP

2Myb_DNA-binding55.21.6e-175699146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     r ++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
       CA03g23210 56 RSPFTEEEEERLLSSHRIHGNR-WAMIARLFP-GRTDNAVKNHWHV 99
                     789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.083154IPR017930Myb domain
SMARTSM007179.9E-17352IPR001005SANT/Myb domain
PfamPF002497.7E-18450IPR001005SANT/Myb domain
SuperFamilySSF466897.86E-30497IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-27557IPR009057Homeodomain-like
CDDcd001671.16E-14748No hitNo description
PROSITE profilePS5129421.28755105IPR017930Myb domain
SMARTSM007175.8E-1555103IPR001005SANT/Myb domain
PfamPF002494.9E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-2158104IPR009057Homeodomain-like
CDDcd001674.00E-66798No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MCSRGHWRPH EDEKLKELVA KYGPHNWNAI AENLQGRSGK SCRLRWYNQL DPRINRSPFT  60
EEEEERLLSS HRIHGNRWAM IARLFPGRTD NAVKNHWHVI MSRRCRERSK IYSNRAAAAQ  120
KSTDQQDNIN NIQDMMIRKR SSNNFIDHQQ LLERYSNCYQ FSSYDHNSFY PTEFHFNHLP  180
RHFKMDNQGT YTFMHAWFKL EFSIVKSVVP FYDVRAMEIA SCKNAR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-3541057108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754422e-89HG975442.1 Solanum pennellii chromosome ch03, complete genome.
GenBankHG9755152e-89HG975515.1 Solanum lycopersicum chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016563961.11e-133PREDICTED: transcriptional activator Myb-like isoform X1
TrEMBLM1D2B81e-92M1D2B8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000797144e-92(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-66myb domain protein 52